PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g16770.1
Common NameLR48_Vigan01g301700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 591aa    MW: 64000.4 Da    PI: 6.9133
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g16770.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like48.81.5e-151471772555
         G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Vang11g16770.1 147 GKAVPKKILELMNVPGLTRENVASHLQKYRL 177
                     59****************************8 PP

2Response_reg56.71.4e-194212725109
                     EEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
    Response_reg  25 evaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                     +v+ +  +e al ll+e++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a + ++ + + +  Ga d+l Kp+ +e+l +
  Vang11g16770.1  42 SVTKCNRAETALSLLRENKngFDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKSVVMKGVTHGACDYLIKPVRIEALKN 127
                     466677788899999888778**********************6654.8**********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.9E-3223144No hitNo description
SuperFamilySSF521723.98E-2923140IPR011006CheY-like superfamily
SMARTSM004481.1E-2124129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011030.38925133IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.1E-1626127IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.99E-2227132No hitNo description
SuperFamilySSF466897.35E-9146181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-15147182IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-13148177IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MSTVTTTGVM KSGDVVSNQF PAGLRVLVVD DDPTSFVLVV VSVTKCNRAE TALSLLRENK  60
NGFDIVISDV HMPDMDGFKL LEHIGLEMDL PVIMMSADDG KSVVMKGVTH GACDYLIKPV  120
RIEALKNIWQ HVVRKKKNEW KDAEQSGKAV PKKILELMNV PGLTRENVAS HLQKYRLYLR  180
RLSGVSQHQN NMNNSFLGSQ EATFGTISSI SGIDLQTLAV AGQLPAQSLA TLQAAGLGRS  240
TAKAGVPMPI MDQRNLFSFE NPRVRFGEGQ QQHLSSSKPM NLLLGIPTNM EPKQLANLHQ  300
STQSIASLNM RVNASAPQGN PLLMQMPQSQ PRGQMLSENT GPRVPRLPSS LGQPNVSNGI  360
SNGFLGRNGI AGNNRGPAYN PVPPNSSLLS FPMNQSSEMS VNNSLPLGST PGMSSITTKG  420
SFQEEVTSGI KTSGGFPSYD IFNELHHHKS HDWEITNPGL TYSAPHHANP LQGNIDVSPS  480
VLVHQGFSST QQTGQSRDAT LIGKSMFSVG QGSEQDNLQN AVQHLHPLLV DNSVRVKSER  540
IPDASSQTNL FPDHYGQEDL MSALLKQQEG MGPAESEFEF DAYSLDNIPV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014508686.10.0PREDICTED: two-component response regulator ARR2
RefseqXP_014508687.10.0PREDICTED: two-component response regulator ARR2
RefseqXP_014508688.10.0PREDICTED: two-component response regulator ARR2
SwissprotQ940D02e-87ARR1_ARATH; Two-component response regulator ARR1
TrEMBLA0A0L9TSJ70.0A0A0L9TSJ7_PHAAN; Uncharacterized protein
STRINGGLYMA07G37220.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.25e-88response regulator 1
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]